Peroxiredoxin 4/PRDX4 Antibody orb251566 from Biorbyt

Product Specs
ItemPeroxiredoxin 4/PRDX4 Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb251566
Quantity10 µg, 100 µg
ApplicationsFC, ICC, IF, IHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetPeroxiredoxin 4/PRDX4
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid
NCBI Full Gene Nameperoxiredoxin 4
NCBI Gene AliasesAOE37-2, AOE372, HEL-S-97n, PRX-4
ClonalityPolyclonal
Molecular Weight30540 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: WB: The detection limit for Peroxiredoxin 4 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry, 0.5-1µg/ml, Human, - Immunocytochemistry/Immunofluorescence, 2µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List